Structure of PDB 4m7a Chain N

Receptor sequence

>4m7aN (length=67) Species: 559292 (Saccharomyces cerevisiae S288C)

MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKL
NEIYIRGTFIKFIKLQD

3D structure

• PDB: 4m7a Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
• Chain: N
• Resolution: 2.781 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	W35 N37 R72 T74	W35 N37 R56 T58

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0000956 nuclear-transcribed mRNA catabolic process
• GO:0006396 RNA processing

External links

• PDB: RCSB:4m7a, PDBe:4m7a, PDBj:4m7a
• PDBsum: 4m7a
• PubMed: 24240276
• UniProt: P40070|LSM4_YEAST U6 snRNA-associated Sm-like protein LSm4 (Gene Name=LSM4)