Structure of PDB 4lf4 Chain N

Receptor sequence
>4lf4N (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW
3D structure
PDB4lf4 Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
ChainN
Resolution3.3421 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N A2 R3 K4 A5 K15 F16 V18 R19 Y21 T22 R23 R29 R31 S32 V33 Y34 R35 R41 I42 R45 E46 K58 S60 W61 A1 R2 K3 A4 K14 F15 V17 R18 Y20 T21 R22 R28 R30 S31 V32 Y33 R34 R40 I41 R44 E45 K57 S59 W60
BS02 ZN N C24 C27 C40 C43 C23 C26 C39 C42
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 07:44:15 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4lf4', asym_id = 'N', title = 'Crystal Structure of 30S ribosomal subunit from Thermus thermophilus'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4lf4', asym_id='N', title='Crystal Structure of 30S ribosomal subunit from Thermus thermophilus')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4lf4', asym_id = 'N'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4lf4', asym_id='N')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>