Structure of PDB 4kx6 Chain N

Receptor sequence
>4kx6N (length=243) Species: 595496 (Escherichia coli BW2952) [Search protein sequence]
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPD
LSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIER
DLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCIN
CGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNG
VWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
3D structure
PDB4kx6 Plasticity of the Quinone-binding Site of the Complex II Homolog Quinol:Fumarate Reductase.
ChainN
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES N C57 R58 C62 G63 C65 C77 C57 R58 C62 G63 C65 C77
BS02 F3S N C158 C204 F206 V207 G208 C210 A221 I224 C158 C204 F206 V207 G208 C210 A221 I224
BS03 SF4 N C148 I149 C151 G152 C154 C214 V218 C148 I149 C151 G152 C154 C214 V218
BS04 MQ7 N C204 T205 F206 Q225 K228 C204 T205 F206 Q225 K228
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 12:40:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4kx6', asym_id = 'N', title = 'Plasticity of the Quinone-binding Site of the Complex II Homolog Quinol:Fumarate Reductase.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4kx6', asym_id='N', title='Plasticity of the Quinone-binding Site of the Complex II Homolog Quinol:Fumarate Reductase.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006099,0009055,0016491,0051536,0051537', uniprot = '', pdbid = '4kx6', asym_id = 'N'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006099,0009055,0016491,0051536,0051537', uniprot='', pdbid='4kx6', asym_id='N')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>