Structure of PDB 4ce4 Chain N

Receptor sequence

>4ce4N (length=147) Species: 9825 (Sus scrofa domesticus)

MSSFSKAPQQWATFARVWYLLDGKMQPPGKLAAMASVKLQGLHKPVYHQL
SDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHQKDP
VAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQ

3D structure

• PDB: 4ce4 Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome.
• Chain: N
• Resolution: 4.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	K6 P8 Q10 P28 G29 L50 F67 K75 H80 F87 K98 A107 Y109 G110 M111 K114 N115 L116 H117 R119	K6 P8 Q10 P28 G29 L50 F67 K75 H80 F87 K98 A107 Y109 G110 M111 K114 N115 L116 H117 R119

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 10:43:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ce4', asym_id = 'N', title = 'Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ce4', asym_id='N', title='Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4ce4', asym_id = 'N'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4ce4', asym_id='N')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>