Structure of PDB 4c3e Chain N |
>4c3eN (length=170) Species: 11259 (Human respiratory syncytial virus A2) [Search protein sequence] |
LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRIL KSMDEIDGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLT ELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPA DVLKKTIKNTLDIHKSITIN |
|
PDB | 4c3e Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation. |
Chain | N |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
N |
C7 C15 C21 H25 |
C10 C18 C24 H28 |
|
|
|
|