Structure of PDB 4b3t Chain N

Receptor sequence
>4b3tN (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW
3D structure
PDB4b3t 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
ChainN
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna N A1 R2 K3 A4 L5 K14 F15 V17 R18 Y20 C26 R28 R30 S31 R34 R40 I41 R44 E45 K57 S59 W60 A1 R2 K3 A4 L5 K14 F15 V17 R18 Y20 C26 R28 R30 S31 R34 R40 I41 R44 E45 K57 S59 W60
BS02 ZN N C23 C26 C39 C42 C23 C26 C39 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4b3t, PDBe:4b3t, PDBj:4b3t
PDBsum4b3t
PubMed24473108
UniProtP0DOY6|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)

[Back to BioLiP]