Structure of PDB 4ayb Chain N |
>4aybN (length=65) Species: 2286 (Saccharolobus shibatae) [Search protein sequence] |
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLL SHIDIISEVIHYTRP |
|
PDB | 4ayb Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA. |
Chain | N |
Resolution | 3.202 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.7.6: DNA-directed RNA polymerase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
N |
C10 C44 C45 |
C10 C44 C45 |
|
|
|
|