Structure of PDB 3pip Chain N

Receptor sequence

>3pipN (length=117) Species: 1299 (Deinococcus radiodurans)

PRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRR
NKKRDFRRLWIQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAR
EPEAFKALVDASRNARQ

3D structure

• PDB: 3pip Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
• Chain: N
• Resolution: 3.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	P2 R3 A4 K5 T6 I8 R10 R11 R12 R13 H14 K15 K22 F24 W25 S27 R28 K30 Q31 Y32 R33 N34 F36 Q37 L40 N41 A42 Y45 Y47 R48 D49 K53 K54 R55 F57 R58 R59 W61 I62 Q63 N66 N75 Y76 S77 N81 K84 R92 K93	P1 R2 A3 K4 T5 I7 R9 R10 R11 R12 H13 K14 K21 F23 W24 S26 R27 K29 Q30 Y31 R32 N33 F35 Q36 L39 N40 A41 Y44 Y46 R47 D48 K52 K53 R54 F56 R57 R58 W60 I61 Q62 N65 N74 Y75 S76 N80 K83 R91 K92

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3pip, PDBe:3pip, PDBj:3pip
• PDBsum: 3pip
• PubMed: 21282615
• UniProt: Q9RSW7|RL20_DEIRA Large ribosomal subunit protein bL20 (Gene Name=rplT)