Structure of PDB 3jam Chain N

Receptor sequence

>3jamN (length=150) Species: 28985 (Kluyveromyces lactis)

GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIG
VLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKH
LERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN

3D structure

• PDB: 3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
• Chain: N
• Resolution: 3.46 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	G2 R3 M4 H5 S6 K9 G10 M11 S12 S14 A15 P17 R20 S48 G51 V52 R55 T61 K64 K70 I71 L72 R73 D87 F90 L91 K94 H101 R104 N105 K107 D108 K109 D110 F113 R114 I116 L117 S120 R121 R124 R127 Y128	G1 R2 M3 H4 S5 K8 G9 M10 S11 S13 A14 P16 R19 S47 G50 V51 R54 T60 K63 K69 I70 L71 R72 D86 F89 L90 K93 H100 R103 N104 K106 D107 K108 D109 F112 R113 I115 L116 S119 R120 R123 R126 Y127

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jam, PDBe:3jam, PDBj:3jam
• PDBsum: 3jam
• PubMed: 26212456
• UniProt: Q6CJK0