Structure of PDB 3j9m Chain N

Receptor sequence

>3j9mN (length=205) Species: 9606 (Homo sapiens)

KPKLRFIERAPLVPKVRREPKNLSDIRGPSTEATEFTEGNFAILALGGGY
LHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGHRMGGGKGA
IDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAKAVSRGTLE
KMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGKYWGKFY
MPKRV

3D structure

• PDB: 3j9m Ribosome. The structure of the human mitochondrial ribosome.
• Chain: N
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	R63 R64 P66 K67 N68 L69 R73 Y96 G100 H101 M104 R111 G137 R139 M140 G141 G143 K144 Q178 K182 R227 K228 V229 S231 P232 Y233 K244	R17 R18 P20 K21 N22 L23 R27 Y50 G54 H55 M58 R65 G91 R93 M94 G95 G97 K98 Q132 K136 R181 K182 V183 S185 P186 Y187 K198
BS02	peptide	N	E168 E170 E171	E122 E124 E125

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j9m, PDBe:3j9m, PDBj:3j9m
• PDBsum: 3j9m
• PubMed: 25838379
• UniProt: Q9NX20|RM16_HUMAN Large ribosomal subunit protein uL16m (Gene Name=MRPL16)