Structure of PDB 3hkz Chain N |
>3hkzN (length=64) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] |
MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLL SHVDIINEVIHYTR |
|
PDB | 3hkz The X-ray crystal structure of RNA polymerase from Archaea. |
Chain | N |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.7.6: DNA-directed RNA polymerase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
N |
C10 C44 C45 |
C10 C44 C45 |
|
|
|
|