Structure of PDB 2zjr Chain N

Receptor sequence

>2zjrN (length=117) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

PRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRR
NKKRDFRRLWIQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAR
EPEAFKALVDASRNARQ

3D structure

PDB

2zjr Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.

Chain

Resolution

2.91 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	P2 R3 K5 T6 I8 V9 R10 R11 R13 H14 K15 K22 G23 F24 W25 G26 S27 R28 Q31 Y32 R33 F36 Q37 N41 Y45 Y47 R48 D49 R50 R51 K53 K54 R55 F57 R58 R59 W61 I62 R70 N75 Y76 S77 N81 K84 K93	P1 R2 K4 T5 I7 V8 R9 R10 R12 H13 K14 K21 G22 F23 W24 G25 S26 R27 Q30 Y31 R32 F35 Q36 N40 Y44 Y46 R47 D48 R49 R50 K52 K53 R54 F56 R57 R58 W60 I61 R69 N74 Y75 S76 N80 K83 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:2zjr, PDBe:2zjr, PDBj:2zjr
PDBsum	2zjr
PubMed	18406324
UniProt	Q9RSW7\|RL20_DEIRA Large ribosomal subunit protein bL20 (Gene Name=rplT)