Structure of PDB 2y69 Chain N

Receptor sequence

>2y69N (length=513) Species: 9913 (Bos taurus)

FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDD
QIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMS
FWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLH
LAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPV
LAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGF
GMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDT
RAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVG
GLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFS
GYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWN
TISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPP
YHTFEEPTYVNLK

3D structure

• PDB: 2y69 A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
• Chain: N
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y19 V29 L33 I37 V58 H61 N80 D91 N98 S101 L105 W126 S156 S157 G160 T167 H240 E242 Y244 S255 G272 H290 H291 T316 K319 H376 F377 H378 R438 R439
• Catalytic site (residue number reindexed from 1): Y18 V28 L32 I36 V57 H60 N79 D90 N97 S100 L104 W125 S155 S156 G159 T166 H239 E241 Y243 S254 G271 H289 H290 T315 K318 H375 F376 H377 R437 R438
• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEA	N	G27 S34 I37 R38 Y54 V58 H61 A62 M65 M69 G125 W126 Y371 F377 H378 S382 V386 F425 R438 R439 M468	G26 S33 I36 R37 Y53 V57 H60 A61 M64 M68 G124 W125 Y370 F376 H377 S381 V385 F424 R437 R438 M467
BS02	HEA	N	W236 V243 Y244 H290 H291 G317 G352 G355 I356 L358 A359 D364 H368 V373 H376 F377 V380 L381 R438	W235 V242 Y243 H289 H290 G316 G351 G354 I355 L357 A358 D363 H367 V372 H375 F376 V379 L380 R437
BS03	CU	N	H240 H290 H291	H239 H289 H290
BS04	OXY	N	H240 V243 H291	H239 V242 H290
BS05	MG	N	H368 D369	H367 D368

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
• GO:0009060 aerobic respiration
• GO:0015990 electron transport coupled proton transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045277 respiratory chain complex IV

External links

• PDB: RCSB:2y69, PDBe:2y69, PDBj:2y69
• PDBsum: 2y69
• PubMed: 21211513
• UniProt: P00396|COX1_BOVIN Cytochrome c oxidase subunit 1 (Gene Name=MT-CO1)