Structure of PDB 2y0s Chain N |
>2y0sN (length=64) Species: 2286 (Saccharolobus shibatae) [Search protein sequence] |
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLL SHIDIISEVIHYTR |
|
PDB | 2y0s Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit. |
Chain | N |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.7.6: DNA-directed RNA polymerase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
N |
C7 C10 C44 C45 |
C7 C10 C44 C45 |
|
|
|
|