Structure of PDB 2hhh Chain N

Receptor sequence

>2hhhN (length=60) Species: 300852 (Thermus thermophilus HB8)

ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW

3D structure

• PDB: 2hhh The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
• Chain: N
• Resolution: 3.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	A2 R3 K4 A5 L6 E8 K11 K15 F16 V18 R19 Y21 T22 R23 C27 R29 R31 S32 Y34 R35 R41 I42 R45 E46 K58 S60 W61	A1 R2 K3 A4 L5 E7 K10 K14 F15 V17 R18 Y20 T21 R22 C26 R28 R30 S31 Y33 R34 R40 I41 R44 E45 K57 S59 W60

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2hhh, PDBe:2hhh, PDBj:2hhh
• PDBsum: 2hhh
• PubMed: 16998488
• UniProt: P0DOY6|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)