Structure of PDB 1q90 Chain N

Receptor sequence
>1q90N (length=31) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
GEPAIVQIGWAATCVMFSFSLSLVVWGRSGL
3D structure
PDB1q90 An Atypical Haem in the Cytochrome B6F Complex
ChainN
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCR N F84 L88 F17 L21
Gene Ontology
Molecular Function
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0017004 cytochrome complex assembly
Cellular Component
GO:0009512 cytochrome b6f complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1q90, PDBe:1q90, PDBj:1q90
PDBsum1q90
PubMed14647374
UniProtP0C1D4|PETN_CHLRE Cytochrome b6-f complex subunit 8, chloroplastic (Gene Name=PETN)

[Back to BioLiP]