Structure of PDB 1q81 Chain N

Receptor sequence

>1q81N (length=194) Species: 2238 (Haloarcula marismortui)

ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRAR
SLGYKAKQGIIVVRVAIRKGSSRRTRFNKGRRSKRMMVNRITRKKNIQRI
AEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWI
SRTRHRLRTFRGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA

3D structure

• PDB: 1q81 Structural Insights into Peptide Bond Formation
• Chain: N
• Resolution: 2.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	A1 S3 Y5 R9 K13 K16 W25 Q29 R32 P35 A36 R39 R42 R45 L46 R48 R50 S51 L52 K55 A56 Q58 R68 K69 G70 S71 R73 R74 T75 R76 F77 K79 G80 R81 R82 S83 K84 R85 M86 N89 R90 T92 R93 K94 K95 N96 I97 R99 I100 R104 R107 K108 F109 P110 N111 N116 G124 R125 K127 D135 D137 H138 P139 A140 Q146 W149 T153 R154 R156 L157 F160 R161 L163 S165 R168 C170 R171 G172 R174 Q176 G177 K178 G179 E181 K182 R184 P185 S186 L187 R188 V189 G191 A192 K193	A1 S3 Y5 R9 K13 K16 W25 Q29 R32 P35 A36 R39 R42 R45 L46 R48 R50 S51 L52 K55 A56 Q58 R68 K69 G70 S71 R73 R74 T75 R76 F77 K79 G80 R81 R82 S83 K84 R85 M86 N89 R90 T92 R93 K94 K95 N96 I97 R99 I100 R104 R107 K108 F109 P110 N111 N116 G124 R125 K127 D135 D137 H138 P139 A140 Q146 W149 T153 R154 R156 L157 F160 R161 L163 S165 R168 C170 R171 G172 R174 Q176 G177 K178 G179 E181 K182 R184 P185 S186 L187 R188 V189 G191 A192 K193

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1q81, PDBe:1q81, PDBj:1q81
• PDBsum: 1q81
• PubMed: 12185246
• UniProt: P60618|RL15E_HALMA Large ribosomal subunit protein eL15 (Gene Name=rpl15e)