Structure of PDB 1nji Chain N

Receptor sequence

>1njiN (length=194) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRAR
SLGYKAKQGIIVVRVAIRKGSSRRTRFNKGRRSKRMMVNRITRKKNIQRI
AEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWI
SRTRHRLRTFRGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA

3D structure

PDB

1nji Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	A1 S3 Y5 R9 K13 K16 W25 Q29 R32 P35 A36 R39 R42 R45 L46 R48 R50 S51 L52 K55 A56 Q58 R68 K69 G70 S71 R73 R74 T75 R76 F77 K79 G80 R81 R82 S83 K84 R85 M86 V88 N89 R90 T92 R93 K94 K95 N96 I97 R99 I100 R104 R107 F109 P110 N111 N116 G124 K127 D135 D137 H138 P139 A140 Q146 W149 T153 R154 R156 L157 F160 R161 L163 S165 R168 C170 R171 G172 R174 Q176 G177 K178 G179 E181 K182 R184 P185 S186 L187 R188 V189 G191 A192 K193	A1 S3 Y5 R9 K13 K16 W25 Q29 R32 P35 A36 R39 R42 R45 L46 R48 R50 S51 L52 K55 A56 Q58 R68 K69 G70 S71 R73 R74 T75 R76 F77 K79 G80 R81 R82 S83 K84 R85 M86 V88 N89 R90 T92 R93 K94 K95 N96 I97 R99 I100 R104 R107 F109 P110 N111 N116 G124 K127 D135 D137 H138 P139 A140 Q146 W149 T153 R154 R156 L157 F160 R161 L163 S165 R168 C170 R171 G172 R174 Q176 G177 K178 G179 E181 K182 R184 P185 S186 L187 R188 V189 G191 A192 K193

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1nji, PDBe:1nji, PDBj:1nji
PDBsum	1nji
PubMed	12860128
UniProt	P60618\|RL15E_HALMA Large ribosomal subunit protein eL15 (Gene Name=rpl15e)

[Back to BioLiP]