Structure of PDB 1kfy Chain N

Receptor sequence

>1kfyN (length=243) Species: 562 (Escherichia coli)

AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPD
LSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIER
DLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCIN
CGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNG
VWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR

3D structure

• PDB: 1kfy Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
• Chain: N
• Resolution: 3.6 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	N	C57 R58 C62 G63 C65 C77	C57 R58 C62 G63 C65 C77
BS02	F3S	N	C158 P159 C204 F206 V207 G208 C210 I224	C158 P159 C204 F206 V207 G208 C210 I224
BS03	SF4	N	C148 I149 N150 C151 G152 C154 C214 V218	C148 I149 N150 C151 G152 C154 C214 V218
BS04	BRS	N	T205 F206 Q225 K228	T205 F206 Q225 K228

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0006113 fermentation
• GO:0009061 anaerobic respiration
• GO:0019645 anaerobic electron transport chain
• GO:0044780 bacterial-type flagellum assembly

Cellular Component

• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0045283 fumarate reductase complex

External links

• PDB: RCSB:1kfy, PDBe:1kfy, PDBj:1kfy
• PDBsum: 1kfy
• PubMed: 11850430
• UniProt: P0AC47|FRDB_ECOLI Fumarate reductase iron-sulfur subunit (Gene Name=frdB)