Structure of PDB 1i97 Chain N

Receptor sequence
>1i97N (length=60) Species: 274 (Thermus thermophilus) [Search protein sequence]
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW
3D structure
PDB1i97 Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
ChainN
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N R3 A5 R19 S32 R2 A4 R18 S31
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i97, PDBe:1i97, PDBj:1i97
PDBsum1i97
PubMed11296217
UniProtP0DOY6|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)

[Back to BioLiP]