Structure of PDB 1dgr Chain N |
>1dgrN (length=76) Species: 3823 (Canavalia ensiformis) [Search protein sequence] |
DKPFNLRSRDPIYSNNYGKLYEITPEKNSQLRDLDILLNCLQMNEGALFV PHYNSRATVILVANEGRAEVELVGLE |
|
PDB | 1dgr X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin. |
Chain | N |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PO4 |
N |
H297 N299 |
H52 N54 |
|
|
|