Structure of PDB 1b33 Chain N |
>1b33N (length=67) Species: 83541 (Mastigocladus laminosus) [Search protein sequence] |
GRLFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKI VKVELATGKQGINTGLA |
|
PDB | 1b33 Structural analysis at 2.2 A of orthorhombic crystals presents the asymmetry of the allophycocyanin-linker complex, AP.LC7.8, from phycobilisomes of Mastigocladus laminosus. |
Chain | N |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BLA |
N |
S12 R20 L22 T25 |
S12 R20 L22 T25 |
|
|
|
|