Structure of PDB 1a6v Chain N |
>1a6vN (length=109) Species: 10090 (Mus musculus) [Search protein sequence] |
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLI GGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHWVF GGGTKLTVL |
|
PDB | 1a6v A Functional Antibody Mutant with an Insertion in the Framework Region 3 Loop of the Vh Domain: Implications for Antibody Engineering |
Chain | N |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NPC |
N |
T31 S32 Y34 W93 |
T31 S32 Y34 W93 |
|
|
|
|