Structure of PDB 7q7q Chain MMM

Receptor sequence

>7q7qMMM (length=323) Species: 1079 (Blastochloris viridis) [Search protein sequence]

ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIY
LGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQY
GMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAA
AIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWH
GFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFW
RWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHG
AAPDYPAYLPATPDPASLPGAPK

3D structure

PDB

7q7q Lipidic cubic phase serial femtosecond crystallography structure of a photosynthetic reaction centre.

Chain

MMM

Resolution

2.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCB	MMM	G201 I204 G205 Y208	G201 I204 G205 Y208
BS02	BPB	MMM	Y208 L212 W250	Y208 L212 W250
BS03	FE2	MMM	H217 E232 H264	H217 E232 H264
BS04	MQ9	MMM	H217 A247 W250 F256 N257 A258 V263 W266	H217 A247 W250 F256 N257 A258 V263 W266
BS05	BCB	MMM	H180 I181 L184	H180 I181 L184
BS06	BCB	MMM	F154 V155 S188 F194 Y195 H200 S203 I204 M275 A278 I282	F154 V155 S188 F194 Y195 H200 S203 I204 M275 A278 I282
BS07	BPB	MMM	I66 S123 W127 N147 F148 S271 M275	I66 S123 W127 N147 F148 S271 M275
BS08	NS5	MMM	G117 M120 G159 F175 H180	G117 M120 G159 F175 H180
BS09	UQ2	MMM	F88 F89	F88 F89

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q7q, PDBe:7q7q, PDBj:7q7q
PDBsum	7q7q
PubMed	35647917
UniProt	P06010\|RCEM_BLAVI Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]