Structure of PDB 8rdw Chain MM

Receptor sequence

>8rdwMM (length=116) Species: 45610 (Psychrobacter urativorans)

ARIAGVNIPDNKHAVISLTYIFGVGRTTAQKILEAVGIAPTTKVSQLDDI
QLDAIRAQVANYMTEGDLRREVSMNIKRLVDLGCYRGIRHRRNLPVRGQN
TKNNARTRKGPTRPLK

3D structure

• PDB: 8rdw A new family of bacterial ribosome hibernation factors
• Chain: MM
• Resolution: 2.74 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	MM	K13 H14 I17 F23 G24 V25 G26 R27 T28 T29 Y86 R87 R90 H91 P96 V97 R98 G99 Q100 N101 T102 K103 N104 N105 A106 R107 T108 K110 R114 L116	K12 H13 I16 F22 G23 V24 G25 R26 T27 T28 Y85 R86 R89 H90 P95 V96 R97 G98 Q99 N100 T101 K102 N103 N104 A105 R106 T107 K109 R113 L115

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rdw, PDBe:8rdw, PDBj:8rdw
• PDBsum: 8rdw
• PubMed: 38355796
• UniProt: A0A0M5MJL8