Structure of PDB 8rd8 Chain MM

Receptor sequence
>8rd8MM (length=110) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]
ARIAGVNIPDNKHAVISLTYIFGVGRTTAQKILEAVGIAPTTKVSQLDDI
QLDAIRAQVANYMTEGDLRREVSMNIKRLVDLGCYRGIRHRRNLPVRGQN
TKNNARTRKG
3D structure
PDB8rd8 A new family of bacterial ribosome hibernation factors
ChainMM
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna MM H14 I17 F23 G24 V25 G26 R27 T28 T29 N76 Y86 R87 R90 H91 L95 P96 V97 R98 Q100 N101 T102 K103 N104 N105 A106 R107 T108 K110 H13 I16 F22 G23 V24 G25 R26 T27 T28 N75 Y85 R86 R89 H90 L94 P95 V96 R97 Q99 N100 T101 K102 N103 N104 A105 R106 T107 K109
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
PDBsum8rd8
PubMed38355796
UniProtA0A0M5MJL8

[Back to BioLiP]