Structure of PDB 8cku Chain MM

Receptor sequence

>8ckuMM (length=215) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEY

3D structure

• PDB: 8cku mRNA reading frame maintenance during eukaryotic ribosome translocation
• Chain: MM
• Resolution: 3.11 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	MM	R3 R4 A6 R7 K15 Y17 Y22 K30 Y34 K39 K40 S61 E63 A64 A67 R88 R90 H92 F94 R98 G107 M115 R116 G117 A118 W119 G120 Y157 K158 P160 D193 G194 F196 K198	R2 R3 A5 R6 K14 Y16 Y21 K29 Y33 K38 K39 S60 E62 A63 A66 R87 R89 H91 F93 R97 G106 M114 R115 G116 A117 W118 G119 Y156 K157 P159 D192 G193 F195 K197
BS02	rna	MM	Y11 E56 L57 K202 K203 G204 S205 L206 N209	Y10 E55 L56 K201 K202 G203 S204 L205 N208
BS03	rna	MM	A25 K101 C105 A106 R110 L111	A24 K100 C104 A105 R109 L110

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cku, PDBe:8cku, PDBj:8cku
• PDBsum: 8cku
• PubMed: 38030725
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)