Structure of PDB 8ipb Chain MB

Receptor sequence

>8ipbMB (length=110) Species: 4565 (Triticum aestivum) [Search protein sequence]

VKGRTGQRVRLYVRGTILGYKRSKSNQYETASLVQIEGVNTREDVAWYGG
KRMAYVYKAKTKSNGTHYRCIWGKVSRPHGNTGVVRAKFTSNLPAEAMGK
KVRVFMYPSS

3D structure

PDB

8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	MB	V2 K3 R5 T6 G7 Q8 R9 V10 R11 L12 Y13 R15 K22 R23 S24 K25 N27 Q28 Y29 E30 R43 G50 R53 Y58 K59 A60 T62 K63 S64 N65 G66 T67 Y69 K75 R78 H80 G81 N82 T83 R87 K89 S92 N93 P95 A96 E97 R104	V1 K2 R4 T5 G6 Q7 R8 V9 R10 L11 Y12 R14 K21 R22 S23 K24 N26 Q27 Y28 E29 R42 G49 R52 Y57 K58 A59 T61 K62 S63 N64 G65 T66 Y68 K74 R77 H79 G80 N81 T82 R86 K88 S91 N92 P94 A95 E96 R103

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links