Structure of PDB 7qvp Chain MB

Receptor sequence

>7qvpMB (length=393) Species: 9606 (Homo sapiens) [Search protein sequence]

SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKA
GMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRT
FKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFS
SMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERL
EQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKV
ACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLLIKNNASTD
YDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTK
RRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAK

3D structure

PDB

7qvp A distinct mammalian disome collision interface harbors K63-linked polyubiquitination of uS10 to trigger hRQT-mediated subunit dissociation.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	MB	S2 H3 R4 F6 S7 P9 R10 H11 G12 S13 L14 G15 F16 L17 P18 R19 K20 R21 S23 H25 R26 K28 K30 S31 K50 M53 H55 R62 G64 S65 A75 Y92 T95 P96 R97 L99 R100 T101 F102 T104 R116 R117 F118 Y119 K120 N121 H123 K124 K126 K127 K128 A129 F130 K132 Y133 Y156 R161 R174 Q175 K176 K177 E182 T223 K224 G225 G227 Y228 G230 R234 K238 K239 R242 K243 T244 H245 R246 G247 L248 R249 K250 A252 C253 I254 A256 W257 H258 A260 R261 V262 S265 R268 A269 Q271 Y274 H276 R277 T278 E279 I280 N281 L317 G318 V321 H322 G324 K334 G335 C336 V337 T340 K341 K342 R343 L352 K356 R357 S372 K373 F374 G375 H376 R378 M382 K385 M389 K393	S1 H2 R3 F5 S6 P8 R9 H10 G11 S12 L13 G14 F15 L16 P17 R18 K19 R20 S22 H24 R25 K27 K29 S30 K49 M52 H54 R61 G63 S64 A74 Y91 T94 P95 R96 L98 R99 T100 F101 T103 R115 R116 F117 Y118 K119 N120 H122 K123 K125 K126 K127 A128 F129 K131 Y132 Y155 R160 R173 Q174 K175 K176 E181 T222 K223 G224 G226 Y227 G229 R233 K237 K238 R241 K242 T243 H244 R245 G246 L247 R248 K249 A251 C252 I253 A255 W256 H257 A259 R260 V261 S264 R267 A268 Q270 Y273 H275 R276 T277 E278 I279 N280 L311 G312 V315 H316 G318 K328 G329 C330 V331 T334 K335 K336 R337 L346 K350 R351 S366 K367 F368 G369 H370 R372 M376 K379 M383 K387

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0071353	cellular response to interleukin-4

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0032991	protein-containing complex
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qvp, PDBe:7qvp, PDBj:7qvp
PDBsum	7qvp
PubMed	36302773
UniProt	P39023\|RL3_HUMAN Large ribosomal subunit protein uL3 (Gene Name=RPL3)

[Back to BioLiP]