Structure of PDB 5wyk Chain MB

Receptor sequence
>5wykMB (length=184) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MDPRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRGNYVMPNLVDACKK
SGTTDLVVLHEHRGVPTSLTISHFPHGPTAQFSLHNVVMRHDIINAGNQS
EVNPHLIFDNFTTALGKRVVCILKHLFNAGPKKDSERVITFANRGDFISV
RQHVYVRTREGVEIAEVGPRFEMRLFELRLGTLE
3D structure
PDB5wyk Molecular architecture of the 90S small subunit pre-ribosome.
ChainMB
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna MB R94 S97 T98 K105 N118 G120 Y122 V123 E144 V171 I177 N178 Q182 K215 E260 L261 R11 S14 T15 K22 N35 G37 Y39 V40 E61 V88 I94 N95 Q99 K132 E177 L178
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030515 snoRNA binding
GO:0042134 rRNA primary transcript binding
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:0034457 Mpp10 complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wyk, PDBe:5wyk, PDBj:5wyk
PDBsum5wyk
PubMed28244370
UniProtP53941|IMP4_YEAST U3 small nucleolar ribonucleoprotein protein IMP4 (Gene Name=IMP4)

[Back to BioLiP]