Structure of PDB 4wsd Chain M5

Receptor sequence
>4wsdM5 (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLL
3D structure
PDB4wsd Structural insights into the translational infidelity mechanism.
ChainM5
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M5 P2 K3 M4 K5 T6 K8 K12 R13 K15 T17 A18 S19 K26 T27 G28 K29 R30 H31 L32 N33 W34 K39 R42 K44 R46 K47 F48 L50 A51 E54 L60 P1 K2 M3 K4 T5 K7 K11 R12 K14 T16 A17 S18 K25 T26 G27 K28 R29 H30 L31 N32 W33 K38 R41 K43 R45 K46 F47 L49 A50 E53 L59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wsd, PDBe:4wsd, PDBj:4wsd
PDBsum4wsd
PubMed26037619
UniProtQ5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]