Structure of PDB 4u3u Chain M5

Receptor sequence

>4u3uM5 (length=203) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRL
GYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRAT
AEERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPQHKAIRRDARYNWI
CDPVHKHREARGLTATGKKSRGINKGHKFNNTKAGRRKTWKRQNTLSLWR
YRK

3D structure

PDB

4u3u ?

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	M5	G2 Y4 K5 R12 K14 Q15 R24 W28 R31 N34 V35 A40 R41 R44 K47 R49 R50 K54 A55 K56 Q57 R67 R68 G69 N70 R71 K72 R73 P74 K77 G78 Y81 G82 K83 P84 T85 N86 Q87 V89 N90 E91 K93 Y94 Q95 R96 R105 R108 A111 N112 N117 W120 S125 Y127 K128 Q138 H139 K140 A141 R144 R147 W150 P154 H156 K157 H158 A161 R162 L164 A166 K169 K170 S171 R172 I174 K176 G177 H178 K179 F180 N181 N182 R187 R188 K189 W191 K192 R193 Q194 S198 W200 R201 Y202 R203 K204	G1 Y3 K4 R11 K13 Q14 R23 W27 R30 N33 V34 A39 R40 R43 K46 R48 R49 K53 A54 K55 Q56 R66 R67 G68 N69 R70 K71 R72 P73 K76 G77 Y80 G81 K82 P83 T84 N85 Q86 V88 N89 E90 K92 Y93 Q94 R95 R104 R107 A110 N111 N116 W119 S124 Y126 K127 Q137 H138 K139 A140 R143 R146 W149 P153 H155 K156 H157 A160 R161 L163 A165 K168 K169 S170 R171 I173 K175 G176 H177 K178 F179 N180 N181 R186 R187 K188 W190 K191 R192 Q193 S197 W199 R200 Y201 R202 K203
BS02	rna	M5	R38 Q57 Y62 R109 N112 L113 D136 H139	R37 Q56 Y61 R108 N111 L112 D135 H138
BS03	OHX	M5	Q32 K33 N34	Q31 K32 N33

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u3u, PDBe:4u3u, PDBj:4u3u
PDBsum	4u3u
PubMed	25209664
UniProt	P05748\|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)

[Back to BioLiP]