Structure of PDB 7ls1 Chain M3

Receptor sequence
>7ls1M3 (length=122) Species: 10090 (Mus musculus) [Search protein sequence]
VMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPM
YVKLVEALLAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVV
VKDYGKESQAKDVIEEYFKCKK
3D structure
PDB7ls1 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
ChainM3
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M3 I35 R36 E37 K40 D57 E58 L91 V104 C106 S107 I25 R26 E27 K30 D47 E48 L81 V94 C96 S97
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ls1, PDBe:7ls1, PDBj:7ls1
PDBsum7ls1
PubMed34815424
UniProtP63323|RS12_MOUSE Small ribosomal subunit protein eS12 (Gene Name=Rps12)

[Back to BioLiP]