Structure of PDB 6gzz Chain M3

Receptor sequence

>6gzzM3 (length=117) Species: 300852 (Thermus thermophilus HB8)

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVA

3D structure

• PDB: 6gzz Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: M3
• Resolution: 4.13 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M3	R14 T20 Y21 I22 Y23 G24 I25 G26 A28 R29 R44 R80 R88 R91 H92 L96 P97 V98 R99 G100 Q101 R102 R104 T105 N106 A107 R108 K111 K115 T116	R13 T19 Y20 I21 Y22 G23 I24 G25 A27 R28 R43 R79 R87 R90 H91 L95 P96 V97 R98 G99 Q100 R101 R103 T104 N105 A106 R107 K110 K114 T115

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzz, PDBe:6gzz, PDBj:6gzz
• PDBsum: 6gzz
• PubMed: 30301898
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)