Structure of PDB 5fcj Chain M3

Receptor sequence

>5fcjM3 (length=193) Species: 559292 (Saccharomyces cerevisiae S288C)

AISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL
DLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRR
QNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPA
TDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAE

3D structure

• PDB: 5fcj Crystal Structures of the uL3 Mutant Ribosome: Illustration of the Importance of Ribosomal Proteins for Translation Efficiency.
• Chain: M3
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M3	I3 K5 L7 L10 K11 N12 H13 F14 R15 K16 H17 W18 Q19 Q28 K31 K32 R35 R36 R39 R55 R59 A60 P61 T62 V63 Y65 N66 K68 R70 R73 L77 R91 D98 H99 R100 R104 G130 K131 R171 R174 S175 K178 F179 R186	I2 K4 L6 L9 K10 N11 H12 F13 R14 K15 H16 W17 Q18 Q27 K30 K31 R34 R35 R38 R54 R58 A59 P60 T61 V62 Y64 N65 K67 R69 R72 L76 R90 D97 H98 R99 R103 G129 K130 R170 R173 S174 K177 F178 R185
BS02	rna	M3	F26 D27 G30 S34	F25 D26 G29 S33

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5fcj, PDBe:5fcj, PDBj:5fcj
• PDBsum: 5fcj
• PubMed: 26906928
• UniProt: Q12690|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)