Structure of PDB 7r81 Chain M2

Receptor sequence

>7r81M2 (length=131) Species: 5141 (Neurospora crassa) [Search protein sequence]

TVQSERAFQKQPHIFLGGRRWYKDVGLGFRTPAAAIEGQYIDKKCPFTGQ
VSIRGRILSGTVVSTKMHRTIIIRREYLHFIPKYNRYEKRHKNLAAHVSP
AFRVEEGDKVTVGQCRPLSKTVRFNVLRVLP

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M2	E10 H18 F20 W39 K41 D42 V43 G44 L45 K61 K62 Q68 S70 I71 R72 R74 S82 K84 M85 R93 Y95 H97 P100 K101 K107 R108 H109 K110 N111 Q132 R134 P135 S137 K138 T139 R141 F142	E5 H13 F15 W21 K23 D24 V25 G26 L27 K43 K44 Q50 S52 I53 R54 R56 S64 K66 M67 R75 Y77 H79 P82 K83 K89 R90 H91 K92 N93 Q114 R116 P117 S119 K120 T121 R123 F124

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links