Structure of PDB 6hcj Chain M2

Receptor sequence

>6hcjM2 (length=143) Species: 9986 (Oryctolagus cuniculus)

DIQTERAYQKQPTIFQNKKRVKLPRYYKNIGLGFKTPKEAIEGTYIDKKC
PFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMS
VHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKK

3D structure

• PDB: 6hcj ZNF598 Is a Quality Control Sensor of Collided Ribosomes.
• Chain: M2
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M2	Q11 P14 T15 F17 Y36 N39 L42 K58 K59 I68 R69 R71 K81 M82 Q83 Y92 H94 R97 K98 Y99 R101 K104 R105 H106 E130 R132 P133 S135 K136 T137 A149 K152	Q9 P12 T13 F15 Y26 N29 L32 K48 K49 I58 R59 R61 K71 M72 Q73 Y82 H84 R87 K88 Y89 R91 K94 R95 H96 E120 R122 P123 S125 K126 T127 A139 K142

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6hcj, PDBe:6hcj, PDBj:6hcj
• PDBsum: 6hcj
• PubMed: 30293783
• UniProt: G1TRM4|RS11_RABIT Small ribosomal subunit protein uS17 (Gene Name=RPS11)