Structure of PDB 8b2l Chain M1

Receptor sequence
>8b2lM1 (length=52) Species: 4097 (Nicotiana tabacum) [Search protein sequence]
GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTARGPN
SS
3D structure
PDB8b2l Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
ChainM1
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M1 H5 R10 A11 K13 V14 R15 T18 V21 K23 Q24 D25 K26 K27 K28 P30 R31 R33 A34 R37 N41 R42 T46 P57 N58 S60 H4 R9 A10 K12 V13 R14 T17 V20 K22 Q23 D24 K25 K26 K27 P29 R30 R32 A33 R36 N40 R41 T45 P49 N50 S52
BS02 rna M1 G2 K3 H5 G1 K2 H4
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8b2l, PDBe:8b2l, PDBj:8b2l
PDBsum8b2l
PubMed37156858
UniProtA0A1S3XGJ0

[Back to BioLiP]