Structure of PDB 7r81 Chain M1

Receptor sequence

>7r81M1 (length=165) Species: 5141 (Neurospora crassa) [Search protein sequence]

PMRELRIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTF
GIRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGIS
EHIDLGIKYDPGIGIYGMDFYCCMTRPGERVSRRRRAKSRVGATHRITRD
DTVKWFKSRFDAIVR

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	M1	K18 V20 N22 C24 S50 A52 R53 Y54 F59 S68 H70 R96 N97 S99 E100 G105 F106 G107 G126 D128 Y130 R142 R144 R149	K9 V11 N13 C15 S41 A43 R44 Y45 F50 S59 H61 R87 N88 S90 E91 G96 F97 G98 G117 D119 Y121 R133 R135 R140
BS02	rna	M1	M11 Q45 T46 V48 T72 R74 R139 V140 R143 R145 S148 R149 G151 A152 H154	M2 Q36 T37 V39 T63 R65 R130 V131 R134 R136 S139 R140 G142 A143 H145
BS03	rna	M1	T55 R57 R63	T46 R48 R54

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum	7r81
PubMed	34815343
UniProt	Q7RVN0\|RL11_NEUCR Large ribosomal subunit protein uL5 (Gene Name=rpl-11)

[Back to BioLiP]