Structure of PDB 6gzx Chain M1

Receptor sequence

>6gzxM1 (length=117) Species: 300852 (Thermus thermophilus HB8)

RHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHL
IHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLA
ERRRGDGAPLALVELVE

3D structure

• PDB: 6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: M1
• Resolution: 4.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M1	H3 L4 S6 K9 L10 N11 R12 H13 S14 H16 R17 R22 N23 H31 R33 I34 T35 K40 K42 R45 D49 H50 H53 L60 H61 R63 R64 Q71 R77 G92 G93 R96 K99 R104 G106 D107 G108	H2 L3 S5 K8 L9 N10 R11 H12 S13 H15 R16 R21 N22 H30 R32 I33 T34 K39 K41 R44 D48 H49 H52 L59 H60 R62 R63 Q70 R76 G91 G92 R95 K98 R103 G105 D106 G107

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
• PDBsum: 6gzx
• PubMed: 30301898
• UniProt: Q9Z9H5|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)