Structure of PDB 6gzq Chain M1

Receptor sequence
>6gzqM1 (length=117) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHL
IHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLA
ERRRGDGAPLALVELVE
3D structure
PDB6gzq Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainM1
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M1 H3 L4 S6 K9 N11 H13 S14 S15 H16 N23 K26 H31 I34 T35 T36 T37 K42 R45 H50 H53 L60 R63 R64 Q71 R77 R90 G92 R96 K99 G106 D107 H2 L3 S5 K8 N10 H12 S13 S14 H15 N22 K25 H30 I33 T34 T35 T36 K41 R44 H49 H52 L59 R62 R63 Q70 R76 R89 G91 R95 K98 G105 D106
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzq, PDBe:6gzq, PDBj:6gzq
PDBsum6gzq
PubMed30301898
UniProtQ9Z9H5|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)

[Back to BioLiP]