Structure of PDB 5obm Chain M0

Receptor sequence

>5obmM0 (length=212) Species: 559292 (Saccharomyces cerevisiae S288C)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKF
PGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENN
IREFPEYFAAQA

3D structure

• PDB: 5obm Aminoglycoside interactions and impacts on the eukaryotic ribosome.
• Chain: M0
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M0	R3 R4 P5 A6 R7 C8 K13 N14 K15 P16 Y22 Y34 D35 K39 K40 E63 A64 A67 R90 H92 F94 R98 L111 Q112 Q113 G114 M115 R116 A118 W119 Q133 Y157 K158 P160 D193 G194 F196 K198	R2 R3 P4 A5 R6 C7 K12 N13 K14 P15 Y21 Y33 D34 K38 K39 E62 A63 A66 R89 H91 F93 R97 L102 Q103 Q104 G105 M106 R107 A109 W110 Q124 Y148 K149 P151 D184 G185 F187 K189
BS02	rna	M0	Y11 E56 L57 I131 K203 G204 S205 L206 N209	Y10 E55 L56 I122 K194 G195 S196 L197 N200
BS03	MG	M0	R156 Q163	R147 Q154

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5obm, PDBe:5obm, PDBj:5obm
• PDBsum: 5obm
• PubMed: 29208708
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)