Structure of PDB 5ndg Chain M0

Receptor sequence

>5ndgM0 (length=208) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPG
QQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIR
EFPEYFAA

3D structure

PDB

5ndg Aminoglycoside interactions and impacts on the eukaryotic ribosome.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M0	R3 R4 P5 A6 R7 C8 K13 N14 K15 Y22 R24 D35 K39 E63 A64 A67 R90 H92 F94 R98 I99 N100 M115 R116 W119 G120 Y157 K158 P160 D193 G194 A195 F196 K198	R2 R3 P4 A5 R6 C7 K12 N13 K14 Y21 R23 D34 K38 E62 A63 A66 R89 H91 F93 R97 I98 N99 M104 R105 W108 G109 Y146 K147 P149 D182 G183 A184 F185 K187
BS02	rna	M0	E56 L57 K202 K203 G204 S205 L206 N209	E55 L56 K191 K192 G193 S194 L195 N198

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ndg, PDBe:5ndg, PDBj:5ndg
PDBsum	5ndg
PubMed	29208708
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]