Structure of PDB 4u55 Chain M0

Receptor sequence

>4u55M0 (length=211) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFP
GQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNI
REFPEYFAAQA

3D structure

PDB

4u55 ?

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	M0	R3 R4 A6 R7 C8 K13 N14 K15 Y22 Y34 K39 S61 E63 A64 A67 R88 R90 H92 F94 R98 M115 R116 G117 W119 Y157 K158 P160 D193 G194 K198	R2 R3 A5 R6 C7 K12 N13 K14 Y21 Y33 K38 S60 E62 A63 A66 R87 R89 H91 F93 R97 M105 R106 G107 W109 Y147 K148 P150 D183 G184 K188
BS02	rna	M0	Y11 E56 L57 K202 K203 G204 L206 N209	Y10 E55 L56 K192 K193 G194 L196 N199
BS03	MG	M0	R156 Q163	R146 Q153
BS04	OHX	M0	N100 G117	N99 G107

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u55, PDBe:4u55, PDBj:4u55
PDBsum	4u55
PubMed	25209664
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]