Structure of PDB 9ax7 Chain M

Receptor sequence

>9ax7M (length=115) Species: 562 (Escherichia coli)

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKPI

3D structure

• PDB: 9ax7 Structural analysis of noncanonical translation initiation complexes.
• Chain: M
• Resolution: 2.63 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	K13 H14 I17 Y23 G24 V25 G26 T28 R29 I73 S76 Y86 R87 R90 H91 L95 P96 V97 R98 Q100 R101 T102 K103 T104 N105 A106 R107 T108 R109 K110 R113 K114 I116	K12 H13 I16 Y22 G23 V24 G25 T27 R28 I72 S75 Y85 R86 R89 H90 L94 P95 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 R112 K113 I115
BS02	rna	M	K78 M81 R92	K77 M80 R91

External links

• PDB: RCSB:9ax7, PDBe:9ax7, PDBj:9ax7
• PDBsum: 9ax7
• PubMed: 39222680
• UniProt: A0A7U9IV78