Structure of PDB 8wdv Chain M

Receptor sequence

>8wdvM (length=318) Species: 572477 (Allochromatium vinosum DSM 180) [Search protein sequence]

PEYQNIFTTVQVRAPAYPGVPLPKGSLPRIGKPIFSYWAGKIGDAQIGPI
YLGFTGTLSIIFGFMAIFIIGFNMLASVDWNIIQFVKHFFWLGLEPPAPQ
YGLTIPPLSEGGWWLMAGFFLTMSILLWWVRTYKRAEALGMSQHLSWAFA
AAIFFYLSLGFIRPVMMGSWAEAVPFGIFPHLDWTAAFSIRYGNLYYNPF
HMLSIAFLYGSALLFAMHGATILAVSRFGGDREIDQITDRGTAAERAAIF
WRWTMGFNASMESIHRWAWWCAVLTVITAGIGILLTGTVVENWYLWAIKH
GVAPAYPEVVTAVDPYAT

3D structure

PDB

8wdv High-resolution structure and biochemical properties of the LH1-RC photocomplex from the model purple sulfur bacterium, Allochromatium vinosum

Chain

Resolution

2.24 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	M	Y210 L214 A217 M218 W252	Y209 L213 A216 M217 W251
BS02	BCL	M	Y157 L160 I179 H182 L183	Y156 L159 I178 H181 L182
BS03	UQ8	M	F90 F91	F89 F90
BS04	FE	M	H219 E234 H266	H218 E233 H265
BS05	BCL	M	M203 I206 A207 Y210 G211 L214	M202 I205 A206 Y209 G210 L213
BS06	BCL	M	I126 A153 F156 L160 T186 F189 L196 Y197 H202 S205 I206 Y210 A280 I284	I125 A152 F155 L159 T185 F188 L195 Y196 H201 S204 I205 Y209 A279 I283
BS07	BPH	M	S60 I61 F65 I68 W129 L146 A149 F150 A153 A273 V277	S59 I60 F64 I67 W128 L145 A148 F149 A152 A272 V276
BS08	MQ8	M	M218 H219 T222 A248 W252 M256 F258 N259 A260 S261 M262 I265 W268	M217 H218 T221 A247 W251 M255 F257 N258 A259 S260 M261 I264 W267
BS09	CRT	M	I68 G72 M75 G119 F120 Y157 G161 V175 F177 G178 H182	I67 G71 M74 G118 F119 Y156 G160 V174 F176 G177 H181

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wdv, PDBe:8wdv, PDBj:8wdv
PDBsum	8wdv
PubMed	38347078
UniProt	P51763\|RCEM_ALLVD Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]