Structure of PDB 8wdu Chain M

Receptor sequence

>8wduM (length=318) Species: 572477 (Allochromatium vinosum DSM 180) [Search protein sequence]

PEYQNIFTTVQVRAPAYPGVPLPKGSLPRIGKPIFSYWAGKIGDAQIGPI
YLGFTGTLSIIFGFMAIFIIGFNMLASVDWNIIQFVKHFFWLGLEPPAPQ
YGLTIPPLSEGGWWLMAGFFLTMSILLWWVRTYKRAEALGMSQHLSWAFA
AAIFFYLSLGFIRPVMMGSWAEAVPFGIFPHLDWTAAFSIRYGNLYYNPF
HMLSIAFLYGSALLFAMHGATILAVSRFGGDREIDQITDRGTAAERAAIF
WRWTMGFNASMESIHRWAWWCAVLTVITAGIGILLTGTVVENWYLWAIKH
GVAPAYPEVVTAVDPYAT

3D structure

PDB

8wdu High-resolution structure and biochemical properties of the LH1-RC photocomplex from the model purple sulfur bacterium, Allochromatium vinosum

Chain

Resolution

2.24 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	M	Y210 L214 A217 M218 W252	Y209 L213 A216 M217 W251
BS02	BCL	M	Y157 L160 V175 I179 H182 L183	Y156 L159 V174 I178 H181 L182
BS03	UQ8	M	V87 F90 F91	V86 F89 F90
BS04	FE	M	H219 E234 H266	H218 E233 H265
BS05	BCL	M	M203 I206 A207 Y210 L214	M202 I205 A206 Y209 L213
BS06	BCL	M	I126 F156 T186 F189 S190 L196 Y197 H202 S205 I206 Y210 A280 G283 I284	I125 F155 T185 F188 S189 L195 Y196 H201 S204 I205 Y209 A279 G282 I283
BS07	BPH	M	L53 I61 G64 F65 I68 S125 I126 W129 L146 A149 F150 A153 A273 V277	L52 I60 G63 F64 I67 S124 I125 W128 L145 A148 F149 A152 A272 V276
BS08	MQ8	M	M218 H219 T222 A248 A249 W252 M256 F258 N259 A260 M262 I265 W268	M217 H218 T221 A247 A248 W251 M255 F257 N258 A259 M261 I264 W267
BS09	CRT	M	G72 M75 F90 G119 F120 T123 Y157 G161 F162 W171 V175 F177 G178 H182	G71 M74 F89 G118 F119 T122 Y156 G160 F161 W170 V174 F176 G177 H181

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wdu, PDBe:8wdu, PDBj:8wdu
PDBsum	8wdu
PubMed	38347078
UniProt	P51763\|RCEM_ALLVD Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]