Structure of PDB 8vtl Chain M

Receptor sequence

>8vtlM (length=301) Species: 1063 (Cereibacter sphaeroides)

EYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIY
LGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEY
GLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFL
SAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPF
HGLSIAFLtGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALF
VRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH
G

3D structure

• PDB: 8vtl Crystal structure of R. sphaeroides Photosynthetic Reaction Center variant Y(M210)2-methoxyphenylalanine
• Chain: M
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	M	G63 L64 F67 W129 A149 F150 A153 A273	G62 L63 F66 W128 A148 F149 A152 A272
BS02	BCL	M	F197 G203 I206 A207 X210 G211 L214	F196 G202 I205 A206 X209 G210 L213
BS03	BCL	M	A153 L156 W157 T186 N187 F189 L196 F197 H202 S205 I206 G280 I284	A152 L155 W156 T185 N186 F188 L195 F196 H201 S204 I205 G279 I283
BS04	FE	M	H219 E234 H266	H218 E233 H265
BS05	SPO	M	F67 G71 W75 W115 S119 W157 G161 F162 H182	F66 G70 W74 W114 S118 W156 G160 F161 H181
BS06	BPH	M	X210 L214	X209 L213
BS07	BCL	M	H182 L183	H181 L182

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:8vtl, PDBe:8vtl, PDBj:8vtl
• PDBsum: 8vtl
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)