Structure of PDB 8s52 Chain M

Receptor sequence

>8s52M (length=289) Species: 9606 (Homo sapiens) [Search protein sequence]

TCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSERVGDSQNPLLSD
GDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADR
INLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTF
KEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQ
VQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDI
AGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL

3D structure

PDB

8s52 Three-step mechanism of promoter escape by RNA polymerase II

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	M	Q102 R104 S109 Y146 A155 K189 R193 K196 R286 R290	Q75 R77 S82 Y119 A128 K162 R166 K169 R259 R263
BS02	rna	M	S50 E51 R66 V67	S37 E38 R39 V40
BS03	dna	M	D69 S70 N103 R105 M115 R154 K178 G247 R248 S249 S252 V283 T284	D42 S43 N76 R78 M88 R127 K151 G220 R221 S222 S225 V256 T257
BS04	ZN	M	C15 H18 C34	C2 H5 C21

Gene Ontology

	Molecular Function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding
GO:0000993	RNA polymerase II complex binding
GO:0003677	DNA binding
GO:0004402	histone acetyltransferase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016251	RNA polymerase II general transcription initiation factor activity
GO:0016407	acetyltransferase activity
GO:0016746	acyltransferase activity
GO:0017025	TBP-class protein binding
GO:0046872	metal ion binding
GO:0046966	nuclear thyroid hormone receptor binding
GO:0061733	peptide-lysine-N-acetyltransferase activity
GO:0140297	DNA-binding transcription factor binding
GO:1990841	promoter-specific chromatin binding

	Biological Process
GO:0001174	transcriptional start site selection at RNA polymerase II promoter
GO:0006338	chromatin remodeling
GO:0006352	DNA-templated transcription initiation
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006473	protein acetylation
GO:0010467	gene expression
GO:0019083	viral transcription
GO:0051123	RNA polymerase II preinitiation complex assembly
GO:0051177	meiotic sister chromatid cohesion
GO:0051225	spindle assembly
GO:0051276	chromosome organization
GO:0070897	transcription preinitiation complex assembly
GO:1904798	positive regulation of core promoter binding
GO:1990114	RNA polymerase II core complex assembly

	Cellular Component
GO:0000776	kinetochore
GO:0000793	condensed chromosome
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005669	transcription factor TFIID complex
GO:0005694	chromosome
GO:0016604	nuclear body
GO:0032153	cell division site
GO:0032993	protein-DNA complex
GO:0042585	germinal vesicle
GO:0090575	RNA polymerase II transcription regulator complex
GO:0097550	transcription preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8s52, PDBe:8s52, PDBj:8s52
PDBsum	8s52
PubMed	38604172
UniProt	Q00403\|TF2B_HUMAN Transcription initiation factor IIB (Gene Name=GTF2B)

[Back to BioLiP]