Structure of PDB 8s1p Chain M

Receptor sequence

>8s1pM (length=135) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNRQIEAA
RIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPG
KVLFEISGVSEEVAREALRLASHKLPIKTKFVKRE

3D structure

• PDB: 8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
• Chain: M
• Resolution: 1.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	P4 K5 R6 K8 Y9 R11 E12 H13 R14 G15 K16 M17 R18 K22 G23 G24 H28 R45 Q46 A49 R56 K63 W65 F69 A76 K77 E80 V81 R82 M83 G84 S85 G86 K87 K101 R119 H123 K124 P126 K128	P4 K5 R6 K8 Y9 R11 E12 H13 R14 G15 K16 M17 R18 K22 G23 G24 H28 R45 Q46 A49 R56 K63 W65 F69 A76 K77 E80 V81 R82 M83 G84 S85 G86 K87 K101 R119 H123 K124 P126 K128
BS02	rna	M	K16 R18 G19	K16 R18 G19

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
• PDBsum: 8s1p
• PubMed: 38811035
• UniProt: P14577|RL16_BACSU Large ribosomal subunit protein uL16 (Gene Name=rplP)